Class b: All beta proteins [48724] (176 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein Syntenin 1 [89311] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries) |
Domain d1n99a1: 1n99 A:112-194 [85459] tandem of two PDZ domains |
PDB Entry: 1n99 (more details), 1.94 Å
SCOPe Domain Sequences for d1n99a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n99a1 b.36.1.1 (A:112-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} previlckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagwss dkahkvlkqafgekitmtirdrp
Timeline for d1n99a1: