Lineage for d1n99a1 (1n99 A:112-194)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373409Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 373410Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 373411Family b.36.1.1: PDZ domain [50157] (24 proteins)
  6. 373516Protein Syntenin 1 [89311] (1 species)
  7. 373517Species Human (Homo sapiens) [TaxId:9606] [89312] (6 PDB entries)
  8. 373527Domain d1n99a1: 1n99 A:112-194 [85459]

Details for d1n99a1

PDB Entry: 1n99 (more details), 1.94 Å

PDB Description: crystal structure of the pdz tandem of human syntenin

SCOP Domain Sequences for d1n99a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n99a1 b.36.1.1 (A:112-194) Syntenin 1 {Human (Homo sapiens)}
previlckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagwss
dkahkvlkqafgekitmtirdrp

SCOP Domain Coordinates for d1n99a1:

Click to download the PDB-style file with coordinates for d1n99a1.
(The format of our PDB-style files is described here.)

Timeline for d1n99a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n99a2