SCOPe 2.05: Domain d1n8vb_: 1n8v B:

Lineage for d1n8vb_ (1n8v B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.21: Chemosensory protein Csp2 [100910] (2 families)
   automatically mapped to Pfam PF03392

5. Family a.118.21.1: Chemosensory protein Csp2 [81898] (2 proteins)

6. Protein Chemosensory protein Csp2 [81899] (1 species)

7. Species Cabbage moth (Mamestra brassicae) [TaxId:55057] [81900] (5 PDB entries)

8. Domain d1n8vb_: 1n8v B: [85458]
   complexed with bromo-dodecanol
   complexed with bdd

Details for d1n8vb_

PDB Entry: 1n8v, 1.39 Å

PDB Description: chemosensory protein in complex with bromo-dodecanol

PDB Compounds: (B:) chemosensory protein

SCOPe Domain Sequences for d1n8vb_:

Sequence; same for both SEQRES and ATOM records:

>d1n8vb_ a.118.21.1 (B:) Chemosensory protein Csp2 {Cabbage moth (Mamestra brassicae) [TaxId: 55057]}
edkytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkcte
nqekgayrviehlikneieiwreltakydptgnwrkkyedrak

Timeline for d1n8vb_:

• d1n8vb_ first appeared in SCOP 1.65
  
• d1n8vb_ appears in SCOPe 2.04
  
• d1n8vb_ appears in SCOPe 2.06
  
• d1n8vb_ appears in the current release, SCOPe 2.08