SCOP 1.71: Domain d1n8rw_: 1n8r W:

Lineage for d1n8rw_ (1n8r W:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.2: Long alpha-hairpin [46556] (13 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (19 PDB entries)

8. Domain d1n8rw_: 1n8r W: [85450]
   Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rx_, d1n8ry_, d1n8rz_
   complexed with cd, cl, k, mg, na, vir; mutant

Details for d1n8rw_

PDB Entry: 1n8r, 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M

SCOP Domain Sequences for d1n8rw_:

Sequence; same for both SEQRES and ATOM records:

>d1n8rw_ a.2.2.1 (W:) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Timeline for d1n8rw_:

• d1n8rw_ first appeared in SCOP 1.65
  
• d1n8rw_ appears in SCOP 1.69
  
• d1n8rw_ appears in SCOP 1.73
  
• d1n8rw_ appears in the current release, SCOPe 2.08