Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) many known members contain KOW motif |
Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
Protein Ribosomal proteins L24 (L24p) [50106] (4 species) |
Species Haloarcula marismortui [TaxId:2238] [50107] (40 PDB entries) Uniprot P10972 |
Domain d1n8ru_: 1n8r U: [85448] Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_ complexed with cd, cl, k, mg, na, vir |
PDB Entry: 1n8r (more details), 3 Å
SCOPe Domain Sequences for d1n8ru_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n8ru_ b.34.5.1 (U:) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]} skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
Timeline for d1n8ru_:
View in 3D Domains from other chains: (mouse over for more information) d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_ |