Lineage for d1n8rs_ (1n8r S:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860696Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 860697Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 860698Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 860699Protein Ribosomal protein L22 [54845] (5 species)
  7. 860700Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
    Uniprot P10970
  8. 860744Domain d1n8rs_: 1n8r S: [85446]
    Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_
    complexed with cd, cl, k, mg, na, vir; mutant

Details for d1n8rs_

PDB Entry: 1n8r (more details), 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M
PDB Compounds: (S:) 50S ribosomal protein L22P

SCOP Domain Sequences for d1n8rs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8rs_ d.55.1.1 (S:) Ribosomal protein L22 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOP Domain Coordinates for d1n8rs_:

Click to download the PDB-style file with coordinates for d1n8rs_.
(The format of our PDB-style files is described here.)

Timeline for d1n8rs_: