Lineage for d1n8rr_ (1n8r R:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946782Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 946783Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 946784Protein Ribosomal proteins L21e [50108] (1 species)
  7. 946785Species Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)
    Uniprot P12734
  8. 946814Domain d1n8rr_: 1n8r R: [85445]
    Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_
    complexed with cd, cl, k, mg, na, vir

Details for d1n8rr_

PDB Entry: 1n8r (more details), 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M
PDB Compounds: (R:) 50S ribosomal protein L21e

SCOPe Domain Sequences for d1n8rr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8rr_ b.34.5.1 (R:) Ribosomal proteins L21e {Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOPe Domain Coordinates for d1n8rr_:

Click to download the PDB-style file with coordinates for d1n8rr_.
(The format of our PDB-style files is described here.)

Timeline for d1n8rr_: