Lineage for d1n8ro_ (1n8r O:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316624Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 317197Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 317198Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 317199Protein Ribosomal protein L18 (L18p) [53139] (2 species)
  7. 317200Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (12 PDB entries)
  8. 317207Domain d1n8ro_: 1n8r O: [85442]
    Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_
    complexed with cd, cl, k, mg, na, vir; mutant

Details for d1n8ro_

PDB Entry: 1n8r (more details), 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M

SCOP Domain Sequences for d1n8ro_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8ro_ c.55.4.1 (O:) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOP Domain Coordinates for d1n8ro_:

Click to download the PDB-style file with coordinates for d1n8ro_.
(The format of our PDB-style files is described here.)

Timeline for d1n8ro_: