Lineage for d1n8rn_ (1n8r N:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716450Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 716451Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 716501Family d.12.1.2: L15e [54193] (1 protein)
    elaborated with additional structures
  6. 716502Protein Ribosomal protein L15e [54194] (1 species)
  7. 716503Species Archaeon Haloarcula marismortui [TaxId:2238] [54195] (40 PDB entries)
  8. 716514Domain d1n8rn_: 1n8r N: [85441]
    Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_
    complexed with cd, cl, k, mg, na, vir; mutant

Details for d1n8rn_

PDB Entry: 1n8r (more details), 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M
PDB Compounds: (N:) 50S ribosomal protein L15e

SCOP Domain Sequences for d1n8rn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8rn_ d.12.1.2 (N:) Ribosomal protein L15e {Archaeon Haloarcula marismortui [TaxId: 2238]}
arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi
ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv
gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs
ekvrpslrvngaka

SCOP Domain Coordinates for d1n8rn_:

Click to download the PDB-style file with coordinates for d1n8rn_.
(The format of our PDB-style files is described here.)

Timeline for d1n8rn_: