![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
![]() | Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) ![]() |
![]() | Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
![]() | Protein Ribosomal protein L15 (L15p) [52082] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [52083] (12 PDB entries) |
![]() | Domain d1n8rm_: 1n8r M: [85440] Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_ complexed with cd, cl, k, mg, na, vir; mutant |
PDB Entry: 1n8r (more details), 3 Å
SCOP Domain Sequences for d1n8rm_:
Sequence, based on SEQRES records: (download)
>d1n8rm_ c.12.1.1 (M:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui} tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl iaddfsegarekvegaggsveltdlgeerq
>d1n8rm_ c.12.1.1 (M:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui} tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf segarekvegaggsveltdlgeerq
Timeline for d1n8rm_:
![]() Domains from other chains: (mouse over for more information) d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_ |