| Class j: Peptides [58231] (121 folds) |
| Fold j.84: Ribosomal protein L10 [64658] (1 superfamily) |
Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) ![]() |
| Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein) |
| Protein Ribosomal protein L10 [64661] (1 species) two alpha-helical segments visible in the crystal structure |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries) Uniprot P15825 |
| Domain d1n8ri_: 1n8r I: [85436] Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_ complexed with cd, cl, k, mg, na, vir; mutant |
PDB Entry: 1n8r (more details), 3 Å
SCOP Domain Sequences for d1n8ri_:
Sequence, based on SEQRES records: (download)
>d1n8ri_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd
>d1n8ri_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd
Timeline for d1n8ri_:
View in 3DDomains from other chains: (mouse over for more information) d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_ |