SCOPe 2.06: Domain d1n8rg2: 1n8r G:80-172

Lineage for d1n8rg2 (1n8r G:80-172)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
   Uniprot P14135

8. Domain d1n8rg2: 1n8r G:80-172 [85434]
   Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_
   complexed with cd, cl, k, mg, na, vir

Details for d1n8rg2

PDB Entry: 1n8r, 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M

PDB Compounds: (G:) 50S ribosomal protein L6P

SCOPe Domain Sequences for d1n8rg2:

Sequence; same for both SEQRES and ATOM records:

>d1n8rg2 d.141.1.1 (G:80-172) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}
weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie
avgqtaadieqltrindkdvrvfqdgvyitrkp

Timeline for d1n8rg2:

• d1n8rg2 first appeared in SCOP 1.65
  
• d1n8rg2 appears in SCOPe 2.05
  
• d1n8rg2 appears in SCOPe 2.07
  
• d1n8rg2 appears in the current release, SCOPe 2.08