![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
![]() | Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) ![]() |
![]() | Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
![]() | Protein Ribosomal protein L6 [56055] (6 species) duplication: consists of two domains of this fold |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries) Uniprot P14135 |
![]() | Domain d1n8rg2: 1n8r G:80-172 [85434] Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_ complexed with cd, cl, k, mg, na, vir; mutant |
PDB Entry: 1n8r (more details), 3 Å
SCOP Domain Sequences for d1n8rg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n8rg2 d.141.1.1 (G:80-172) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]} weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie avgqtaadieqltrindkdvrvfqdgvyitrkp
Timeline for d1n8rg2:
![]() Domains from other chains: (mouse over for more information) d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_ |