Lineage for d1n8rd_ (1n8r D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952099Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 952119Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 952274Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
  6. 952275Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 952316Species Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries)
    Uniprot P20279
  8. 952361Domain d1n8rd_: 1n8r D: [85430]
    Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_
    complexed with cd, cl, k, mg, na, vir

Details for d1n8rd_

PDB Entry: 1n8r (more details), 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M
PDB Compounds: (D:) 50S ribosomal protein L3P

SCOPe Domain Sequences for d1n8rd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8rd_ b.43.3.2 (D:) Ribosomal protein L3 {Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOPe Domain Coordinates for d1n8rd_:

Click to download the PDB-style file with coordinates for d1n8rd_.
(The format of our PDB-style files is described here.)

Timeline for d1n8rd_: