Lineage for d1n8rc1 (1n8r C:91-237)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295568Fold b.34: SH3-like barrel [50036] (13 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 295918Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 295962Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 295963Protein C-terminal domain of ribosomal protein L2 [50115] (2 species)
  7. 295964Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (12 PDB entries)
  8. 295971Domain d1n8rc1: 1n8r C:91-237 [85428]
    Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_
    complexed with cd, cl, k, mg, na, vir; mutant

Details for d1n8rc1

PDB Entry: 1n8r (more details), 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M

SCOP Domain Sequences for d1n8rc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8rc1 b.34.5.3 (C:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOP Domain Coordinates for d1n8rc1:

Click to download the PDB-style file with coordinates for d1n8rc1.
(The format of our PDB-style files is described here.)

Timeline for d1n8rc1: