SCOPe 2.05: Domain d1n8r4_: 1n8r 4:

Lineage for d1n8r4_ (1n8r 4:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
   automatically mapped to Pfam PF00935

6. Protein Ribosomal protein L44e [57837] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
   Uniprot P32411

8. Domain d1n8r4_: 1n8r 4: [85427]
   Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_
   complexed with cd, cl, k, mg, na, vir

Details for d1n8r4_

PDB Entry: 1n8r, 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M

PDB Compounds: (4:) 50S ribosomal protein L44E

SCOPe Domain Sequences for d1n8r4_:

Sequence; same for both SEQRES and ATOM records:

>d1n8r4_ g.41.8.3 (4:) Ribosomal protein L44e {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

Timeline for d1n8r4_:

• d1n8r4_ first appeared in SCOP 1.65
  
• d1n8r4_ appears in SCOPe 2.04
  
• d1n8r4_ appears in SCOPe 2.06
  
• d1n8r4_ appears in the current release, SCOPe 2.08