Lineage for d1n8r3_ (1n8r 3:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1099677Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1099678Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 1099679Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 1099680Protein Ribosomal protein L39e [48664] (1 species)
  7. 1099681Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 1099726Domain d1n8r3_: 1n8r 3: [85426]
    Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_
    complexed with cd, cl, k, mg, na, vir

Details for d1n8r3_

PDB Entry: 1n8r (more details), 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M
PDB Compounds: (3:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d1n8r3_:

Sequence, based on SEQRES records: (download)

>d1n8r3_ a.137.1.1 (3:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1n8r3_ a.137.1.1 (3:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

SCOPe Domain Coordinates for d1n8r3_:

Click to download the PDB-style file with coordinates for d1n8r3_.
(The format of our PDB-style files is described here.)

Timeline for d1n8r3_: