Lineage for d1n8r1_ (1n8r 1:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263551Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2263552Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
    automatically mapped to Pfam PF01780
  6. 2263553Protein Ribosomal protein L37ae [57831] (1 species)
  7. 2263554Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
    Uniprot P60619
  8. 2263587Domain d1n8r1_: 1n8r 1: [85424]
    Other proteins in same PDB: d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_
    complexed with cd, cl, k, mg, na, vir

Details for d1n8r1_

PDB Entry: 1n8r (more details), 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M
PDB Compounds: (1:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d1n8r1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8r1_ g.41.8.1 (1:) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
qpetvagkavmka

SCOPe Domain Coordinates for d1n8r1_:

Click to download the PDB-style file with coordinates for d1n8r1_.
(The format of our PDB-style files is described here.)

Timeline for d1n8r1_: