Lineage for d1n8jc_ (1n8j C:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315307Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 315308Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 315870Family c.47.1.10: Glutathione peroxidase-like [52901] (13 proteins)
  6. 315871Protein Alkyl hydroperoxide reductase AhpC [69516] (1 species)
  7. 315872Species Salmonella typhimurium [TaxId:90371] [69517] (2 PDB entries)
  8. 315875Domain d1n8jc_: 1n8j C: [85403]

Details for d1n8jc_

PDB Entry: 1n8j (more details), 2.17 Å

PDB Description: crystal structure of ahpc with active site cysteine mutated to serine (c46s)

SCOP Domain Sequences for d1n8jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8jc_ c.47.1.10 (C:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium}
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvsptelgdvadhyeel
qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
dlvgki

SCOP Domain Coordinates for d1n8jc_:

Click to download the PDB-style file with coordinates for d1n8jc_.
(The format of our PDB-style files is described here.)

Timeline for d1n8jc_: