![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins) |
![]() | Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species) |
![]() | Species Escherichia coli, phenylalanine-regulated isozyme [TaxId:562] [51601] (4 PDB entries) |
![]() | Domain d1n8fc_: 1n8f C: [85399] complexed with mn, pep, so4; mutant |
PDB Entry: 1n8f (more details), 1.75 Å
SCOPe Domain Sequences for d1n8fc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n8fc_ c.1.10.4 (C:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli, phenylalanine-regulated isozyme [TaxId: 562]} lrikeikellppvallqkfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve gnqslesgeplaygksitdacigwedtdallrqlanavkarrg
Timeline for d1n8fc_: