SCOP 1.73: Domain d1n8fa_: 1n8f A:

Lineage for d1n8fa_ (1n8f A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (8 families)
   Common fold covers whole protein structure

5. Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)

6. Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species)

7. Species Escherichia coli, phenylalanine-regulated isozyme [TaxId:562] [51601] (4 PDB entries)

8. Domain d1n8fa_: 1n8f A: [85397]

Details for d1n8fa_

PDB Entry: 1n8f, 1.75 Å

PDB Description: crystal structure of e24q mutant of phenylalanine-regulated 3-deoxy-d- arabino-heptulosonate-7-phosphate synthase (dahp synthase) from escherichia coli in complex with mn2+ and pep

PDB Compounds: (A:) DAHP Synthetase

SCOP Domain Sequences for d1n8fa_:

Sequence; same for both SEQRES and ATOM records:

>d1n8fa_ c.1.10.4 (A:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli, phenylalanine-regulated isozyme [TaxId: 562]}
lrikeikellppvallqkfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
gnqslesgeplaygksitdacigwedtdallrqlanavkarrg

Timeline for d1n8fa_:

• d1n8fa_ first appeared in SCOP 1.65
  
• d1n8fa_ appears in SCOP 1.71
  
• d1n8fa_ appears in SCOP 1.75
  
• d1n8fa_ appears in the current release, SCOPe 2.08