Lineage for d1n8fa_ (1n8f A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835534Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 2835535Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species)
  7. 2835587Species Escherichia coli, phenylalanine-regulated isozyme [TaxId:562] [51601] (4 PDB entries)
  8. 2835588Domain d1n8fa_: 1n8f A: [85397]
    complexed with mn, pep, so4; mutant

Details for d1n8fa_

PDB Entry: 1n8f (more details), 1.75 Å

PDB Description: crystal structure of e24q mutant of phenylalanine-regulated 3-deoxy-d- arabino-heptulosonate-7-phosphate synthase (dahp synthase) from escherichia coli in complex with mn2+ and pep
PDB Compounds: (A:) DAHP Synthetase

SCOPe Domain Sequences for d1n8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8fa_ c.1.10.4 (A:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli, phenylalanine-regulated isozyme [TaxId: 562]}
lrikeikellppvallqkfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
gnqslesgeplaygksitdacigwedtdallrqlanavkarrg

SCOPe Domain Coordinates for d1n8fa_:

Click to download the PDB-style file with coordinates for d1n8fa_.
(The format of our PDB-style files is described here.)

Timeline for d1n8fa_: