![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
![]() | Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) ![]() |
![]() | Family d.12.1.1: L23p [54190] (1 protein) automatically mapped to Pfam PF00276 |
![]() | Protein Ribosomal protein L23 [54191] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [89815] (11 PDB entries) |
![]() | Domain d1n88a_: 1n88 A: [85391] |
PDB Entry: 1n88 (more details)
SCOPe Domain Sequences for d1n88a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n88a_ d.12.1.1 (A:) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]} mktaydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvr gkkkrlgrylgkrpdrkkaivqvapgqkiealegli
Timeline for d1n88a_: