Lineage for d1n88a_ (1n88 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499758Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 2499759Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 2499760Family d.12.1.1: L23p [54190] (1 protein)
    automatically mapped to Pfam PF00276
  6. 2499761Protein Ribosomal protein L23 [54191] (4 species)
  7. 2499859Species Thermus thermophilus [TaxId:274] [89815] (11 PDB entries)
  8. 2499862Domain d1n88a_: 1n88 A: [85391]

Details for d1n88a_

PDB Entry: 1n88 (more details)

PDB Description: NMR structure of the ribosomal protein L23 from Thermus thermophilus.
PDB Compounds: (A:) ribosomal protein l23

SCOPe Domain Sequences for d1n88a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n88a_ d.12.1.1 (A:) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]}
mktaydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvr
gkkkrlgrylgkrpdrkkaivqvapgqkiealegli

SCOPe Domain Coordinates for d1n88a_:

Click to download the PDB-style file with coordinates for d1n88a_.
(The format of our PDB-style files is described here.)

Timeline for d1n88a_: