Lineage for d1n7xa_ (1n7x A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 321832Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 321833Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 322136Family c.94.1.2: Transferrin [53888] (3 proteins)
    further duplication: composed of two two-domain lobes
  6. 322217Protein Transferrin [53897] (3 species)
  7. 322218Species Human (Homo sapiens) [TaxId:9606] [53899] (16 PDB entries)
  8. 322230Domain d1n7xa_: 1n7x A: [85379]
    N-terminal lobe
    complexed with co3, fe; mutant

Details for d1n7xa_

PDB Entry: 1n7x (more details), 2.1 Å

PDB Description: human serum transferrin, n-lobe y45e mutant

SCOP Domain Sequences for d1n7xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7xa_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens)}
dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkaseldciraiaaneadavtl
daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
lkvpprmdakmylgyeyvtairnlregtc

SCOP Domain Coordinates for d1n7xa_:

Click to download the PDB-style file with coordinates for d1n7xa_.
(The format of our PDB-style files is described here.)

Timeline for d1n7xa_: