Lineage for d1n7va_ (1n7v A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2077367Fold b.126: Adsorption protein p2 [89427] (1 superfamily)
    multisheet protein containing partial beta-propeller and beta-sandwich regions
  4. 2077368Superfamily b.126.1: Adsorption protein p2 [89428] (1 family) (S)
    automatically mapped to Pfam PF09214
  5. 2077369Family b.126.1.1: Adsorption protein p2 [89429] (1 protein)
  6. 2077370Protein Adsorption protein p2 [89430] (1 species)
    synonym: receptor-binding protein p2
  7. 2077371Species Bacteriophage PRD1 [TaxId:10658] [89431] (2 PDB entries)
  8. 2077372Domain d1n7va_: 1n7v A: [85377]
    complexed with act, ca

Details for d1n7va_

PDB Entry: 1n7v (more details), 2.2 Å

PDB Description: the receptor-binding protein p2 of bacteriophage prd1: crystal form iii
PDB Compounds: (A:) Adsorption protein P2

SCOPe Domain Sequences for d1n7va_:

Sequence, based on SEQRES records: (download)

>d1n7va_ b.126.1.1 (A:) Adsorption protein p2 {Bacteriophage PRD1 [TaxId: 10658]}
anfnvpklgvfpvaavfdidnvpedssatgsrwlpsiyqggnywgggpqalhaqvsnfds
snrlpynprtennpagncafafnpfgqyisnissaqsvhrriygidlndeplfspnaasi
tnggnptmsqdtgyhnigpintaykaeifrpvnplpmsdtapdpetlepgqtepliksdg
vysnsgiasfifdrpvtepnpnwpplpppvipiiyptpalgigaaaaygfgyqvtvyrwe
eipvefiadpetcpaqpttdkviirttdlnpegspcayeagiilvrqtsnpmnavagrlv
pyvediavdifltgkfftlnpplritnnyfaddevkentvtignytttlssayyavyktd
gyggatcfiasggagisalvqlqdnsvldvlyyslplslggskaaidewvanncglfpms
ggldkttlleiprrqleainpqdgpgqydlfilddsgayasfssfigypeaayyvagaat
fmdvenpdeiifilrngagwyaceigdalkiaddefdsvdyfayrggvmfigsarytegg
dplpikyraiipglp

Sequence, based on observed residues (ATOM records): (download)

>d1n7va_ b.126.1.1 (A:) Adsorption protein p2 {Bacteriophage PRD1 [TaxId: 10658]}
anfnvpklgvfpvaavfdidnvpedssatgsrwlpsiyqggnywgggpqalhaqvsnfds
snrlpynprtennpagncafafnpfgqyisnissaqsvhrriygidlndeplfspnaasi
tnggnptmsqdtgyhnigpintaykaeifrpvnplpmsdtapdpetlepgqtepliksdg
vysnsgiasfifdrpvtepnpnwpplpppvipiiyptpalgigaaaaygfgyqvtvyrwe
eipveflnpegspcayeagiilvrqtsnpmnavagrlvpyvediavdifltgkfftlnpp
lritnnyfaddevkentvtignytttlssayyavyktdgyggatcfiasggagisalvql
qdnsvldvlyyslplslggskaaidewvanncglfpmsggldkttlleiprrqleainpq
dgpgqydlfilddsgayasfssfigypeaayyvagaatfmdvenpdeiifilrngagwya
ceigdalkiaddefdsvdyfayrggvmfigsaryteggdplpikyraiipglp

SCOPe Domain Coordinates for d1n7va_:

Click to download the PDB-style file with coordinates for d1n7va_.
(The format of our PDB-style files is described here.)

Timeline for d1n7va_: