Lineage for d1n71a_ (1n71 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731000Protein Aminoglycoside 6'-N-acetyltransferase [55731] (1 species)
  7. 731001Species Enterococcus faecium [TaxId:1352] [55732] (3 PDB entries)
  8. 731002Domain d1n71a_: 1n71 A: [85370]

Details for d1n71a_

PDB Entry: 1n71 (more details), 1.8 Å

PDB Description: Crystal structure of aminoglycoside 6'-acetyltransferase type Ii in complex with coenzyme A
PDB Compounds: (A:) aac(6')-Ii

SCOP Domain Sequences for d1n71a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]}
miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd

SCOP Domain Coordinates for d1n71a_:

Click to download the PDB-style file with coordinates for d1n71a_.
(The format of our PDB-style files is described here.)

Timeline for d1n71a_: