Lineage for d1n71a_ (1n71 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968395Protein Aminoglycoside 6'-N-acetyltransferase [55731] (1 species)
  7. 2968396Species Enterococcus faecium [TaxId:1352] [55732] (5 PDB entries)
  8. 2968397Domain d1n71a_: 1n71 A: [85370]
    complexed with coa, so4

Details for d1n71a_

PDB Entry: 1n71 (more details), 1.8 Å

PDB Description: Crystal structure of aminoglycoside 6'-acetyltransferase type Ii in complex with coenzyme A
PDB Compounds: (A:) aac(6')-Ii

SCOPe Domain Sequences for d1n71a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]}
miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd

SCOPe Domain Coordinates for d1n71a_:

Click to download the PDB-style file with coordinates for d1n71a_.
(The format of our PDB-style files is described here.)

Timeline for d1n71a_: