SCOPe 2.05: Domain d1n6va2: 1n6v A:110-212

Lineage for d1n6va2 (1n6v A:110-212)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Interferon-alpha/beta receptor beta chain [89199] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89200] (4 PDB entries)

8. Domain d1n6va2: 1n6v A:110-212 [85366]

Details for d1n6va2

PDB Entry: 1n6v

PDB Description: average structure of the interferon-binding ectodomain of the human type i interferon receptor

PDB Compounds: (A:) Interferon-alpha/beta receptor beta chain

SCOPe Domain Sequences for d1n6va2:

Sequence; same for both SEQRES and ATOM records:

>d1n6va2 b.1.2.1 (A:110-212) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
pefeivgftnhinvmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnftyi
idklipntnycvsvylehsdeqaviksplkctllppgqesefs

Timeline for d1n6va2:

• d1n6va2 first appeared in SCOP 1.65
  
• d1n6va2 appears in SCOPe 2.04
  
• d1n6va2 appears in SCOPe 2.06
  
• d1n6va2 appears in the current release, SCOPe 2.08