Lineage for d1n6va1 (1n6v A:1-109)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 550820Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 550821Family b.1.2.1: Fibronectin type III [49266] (28 proteins)
    Pfam 00041
  6. 550989Protein Interferon-alpha/beta receptor beta chain [89199] (1 species)
  7. 550990Species Human (Homo sapiens) [TaxId:9606] [89200] (2 PDB entries)
  8. 550993Domain d1n6va1: 1n6v A:1-109 [85365]

Details for d1n6va1

PDB Entry: 1n6v (more details)

PDB Description: average structure of the interferon-binding ectodomain of the human type i interferon receptor

SCOP Domain Sequences for d1n6va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6va1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens)}
sydspdytdesctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncan
ttrsfcdltdewrstheayvtvlegfsgnttlfscshnfwlaidmsfep

SCOP Domain Coordinates for d1n6va1:

Click to download the PDB-style file with coordinates for d1n6va1.
(The format of our PDB-style files is described here.)

Timeline for d1n6va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n6va2