Lineage for d1n6va1 (1n6v A:1-109)
- Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (20 proteins) 
Protein Interferon-alpha/beta receptor beta chain [89199] (1 species) Species Human (Homo sapiens) [TaxId:9606] [89200] (2 PDB entries) 
Domain d1n6va1: 1n6v A:1-109 [85365]
Details for d1n6va1
PDB Entry: 1n6v (more details)
PDB Description: average structure of the interferon-binding ectodomain of the human type i interferon receptor
SCOP Domain Sequences for d1n6va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6va1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens)}
sydspdytdesctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncan
ttrsfcdltdewrstheayvtvlegfsgnttlfscshnfwlaidmsfep
SCOP Domain Coordinates for d1n6va1:
Click to download the PDB-style file with coordinates for d1n6va1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n6va1:
- d1n6va1 is new in SCOP 1.65
- d1n6va1 appears in SCOP 1.67
- d1n6va1 appears in the current release, SCOPe 2.08
View in 3D
