| Class b: All beta proteins [48724] (149 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (28 proteins) Pfam 00041 |
| Protein Interferon-alpha/beta receptor beta chain [89199] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89200] (2 PDB entries) |
| Domain d1n6ua1: 1n6u A:1-109 [85363] |
PDB Entry: 1n6u (more details)
SCOP Domain Sequences for d1n6ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6ua1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens)}
sydspdytdesctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncan
ttrsfcdltdewrstheayvtvlegfsgnttlfscshnfwlaidmsfep
Timeline for d1n6ua1: