Lineage for d1n5xb6 (1n5x B:192-414)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437012Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1437013Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1437083Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 1437123Protein Xanthine oxidase, domain 3 (?) [56191] (1 species)
  7. 1437124Species Cow (Bos taurus) [TaxId:9913] [56192] (9 PDB entries)
    Uniprot P80457
  8. 1437141Domain d1n5xb6: 1n5x B:192-414 [85353]
    Other proteins in same PDB: d1n5xa1, d1n5xa2, d1n5xa3, d1n5xa4, d1n5xa5, d1n5xb1, d1n5xb2, d1n5xb3, d1n5xb4, d1n5xb5
    complexed with fad, fes, mos, mte, tei

Details for d1n5xb6

PDB Entry: 1n5x (more details), 2.8 Å

PDB Description: Xanthine Dehydrogenase from Bovine Milk with Inhibitor TEI-6720 Bound
PDB Compounds: (B:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d1n5xb6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5xb6 d.145.1.3 (B:192-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId: 9913]}
spslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaq
hpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvekt
lleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtk
ltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysre

SCOPe Domain Coordinates for d1n5xb6:

Click to download the PDB-style file with coordinates for d1n5xb6.
(The format of our PDB-style files is described here.)

Timeline for d1n5xb6: