Lineage for d1n5xb4 (1n5x B:415-531)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867213Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 867354Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (1 family) (S)
  5. 867355Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 867395Protein Xanthine oxidase, domain 4 (?) [55452] (1 species)
  7. 867396Species Cow (Bos taurus) [TaxId:9913] [55453] (6 PDB entries)
    Uniprot P80457
  8. 867407Domain d1n5xb4: 1n5x B:415-531 [85351]
    Other proteins in same PDB: d1n5xa1, d1n5xa2, d1n5xa3, d1n5xa5, d1n5xa6, d1n5xb1, d1n5xb2, d1n5xb3, d1n5xb5, d1n5xb6
    complexed with fad, fes, mos, mte, tei

Details for d1n5xb4

PDB Entry: 1n5x (more details), 2.8 Å

PDB Description: Xanthine Dehydrogenase from Bovine Milk with Inhibitor TEI-6720 Bound
PDB Compounds: (B:) Xanthine Dehydrogenase

SCOP Domain Sequences for d1n5xb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5xb4 d.87.2.1 (B:415-531) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkds

SCOP Domain Coordinates for d1n5xb4:

Click to download the PDB-style file with coordinates for d1n5xb4.
(The format of our PDB-style files is described here.)

Timeline for d1n5xb4: