SCOP 1.73: Domain d1n5xb4: 1n5x B:415-531

Lineage for d1n5xb4 (1n5x B:415-531)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (1 family)

5. Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)

6. Protein Xanthine oxidase, domain 4 (?) [55452] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55453] (5 PDB entries)

8. Domain d1n5xb4: 1n5x B:415-531 [85351]
   Other proteins in same PDB: d1n5xa1, d1n5xa2, d1n5xa3, d1n5xa5, d1n5xa6, d1n5xb1, d1n5xb2, d1n5xb3, d1n5xb5, d1n5xb6
   complexed with fad, fes, mos, mte, tei

Details for d1n5xb4

PDB Entry: 1n5x, 2.8 Å

PDB Description: Xanthine Dehydrogenase from Bovine Milk with Inhibitor TEI-6720 Bound

PDB Compounds: (B:) Xanthine Dehydrogenase

SCOP Domain Sequences for d1n5xb4:

Sequence; same for both SEQRES and ATOM records:

>d1n5xb4 d.87.2.1 (B:415-531) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkds

Timeline for d1n5xb4:

• d1n5xb4 first appeared in SCOP 1.65
  
• d1n5xb4 appears in SCOP 1.71
  
• d1n5xb4 appears in SCOP 1.75
  
• d1n5xb4 appears in the current release, SCOPe 2.08