![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) ![]() |
![]() | Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (4 proteins) |
![]() | Protein Xanthine oxidase, domain 5 (?) [54670] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [54671] (3 PDB entries) |
![]() | Domain d1n5xb3: 1n5x B:537-694 [85350] Other proteins in same PDB: d1n5xa1, d1n5xa2, d1n5xa4, d1n5xa5, d1n5xa6, d1n5xb1, d1n5xb2, d1n5xb4, d1n5xb5, d1n5xb6 complexed with fad, fes, mos, mte, tei |
PDB Entry: 1n5x (more details), 2.8 Å
SCOP Domain Sequences for d1n5xb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n5xb3 d.41.1.1 (B:537-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus)} kldptytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddi pryenelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfa kdtvtcvghiigavvadtpehaeraahvvkvtyedlpa
Timeline for d1n5xb3: