SCOP 1.67: Domain d1n5xb2: 1n5x B:3-92

Lineage for d1n5xb2 (1n5x B:3-92)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (10 proteins)

6. Protein Xanthine oxidase, N-terminal domain [54318] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54319] (3 PDB entries)

8. Domain d1n5xb2: 1n5x B:3-92 [85349]
   Other proteins in same PDB: d1n5xa1, d1n5xa3, d1n5xa4, d1n5xa5, d1n5xa6, d1n5xb1, d1n5xb3, d1n5xb4, d1n5xb5, d1n5xb6
   complexed with fad, fes, mos, mte, tei

Details for d1n5xb2

PDB Entry: 1n5x, 2.8 Å

PDB Description: Xanthine Dehydrogenase from Bovine Milk with Inhibitor TEI-6720 Bound

SCOP Domain Sequences for d1n5xb2:

Sequence; same for both SEQRES and ATOM records:

>d1n5xb2 d.15.4.2 (B:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus)}
adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
dkiihfsanaclapictlhhvavttvegig

Timeline for d1n5xb2:

• d1n5xb2 first appeared in SCOP 1.65
  
• d1n5xb2 appears in SCOP 1.69
  
• d1n5xb2 appears in the current release, SCOPe 2.08