Class a: All alpha proteins [46456] (284 folds) |
Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) contains 2Fe-2S cluster |
Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins) |
Protein Xanthine oxidase, domain 2 [47746] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [47747] (6 PDB entries) Uniprot P80457 |
Domain d1n5xb1: 1n5x B:93-165 [85348] Other proteins in same PDB: d1n5xa2, d1n5xa3, d1n5xa4, d1n5xa5, d1n5xa6, d1n5xb2, d1n5xb3, d1n5xb4, d1n5xb5, d1n5xb6 complexed with fad, fes, mos, mte, tei |
PDB Entry: 1n5x (more details), 2.8 Å
SCOP Domain Sequences for d1n5xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n5xb1 a.56.1.1 (B:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]} stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg yrpilqgfrtfak
Timeline for d1n5xb1: