![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (4 families) ![]() |
![]() | Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (5 proteins) |
![]() | Protein Xanthine oxidase, domain 3 (?) [56191] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56192] (6 PDB entries) Uniprot P80457 |
![]() | Domain d1n5xa6: 1n5x A:192-414 [85347] Other proteins in same PDB: d1n5xa1, d1n5xa2, d1n5xa3, d1n5xa4, d1n5xa5, d1n5xb1, d1n5xb2, d1n5xb3, d1n5xb4, d1n5xb5 |
PDB Entry: 1n5x (more details), 2.8 Å
SCOP Domain Sequences for d1n5xa6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n5xa6 d.145.1.3 (A:192-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId: 9913]} spslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaq hpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvekt lleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtk ltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysre
Timeline for d1n5xa6: