Lineage for d1n5xa6 (1n5x A:192-414)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 335331Fold d.145: FAD-binding domain [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 335332Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 335383Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (3 proteins)
  6. 335411Protein Xanthine oxidase, domain 3 (?) [56191] (1 species)
  7. 335412Species Cow (Bos taurus) [TaxId:9913] [56192] (3 PDB entries)
  8. 335416Domain d1n5xa6: 1n5x A:192-414 [85347]
    Other proteins in same PDB: d1n5xa1, d1n5xa2, d1n5xa3, d1n5xa4, d1n5xa5, d1n5xb1, d1n5xb2, d1n5xb3, d1n5xb4, d1n5xb5

Details for d1n5xa6

PDB Entry: 1n5x (more details), 2.8 Å

PDB Description: Xanthine Dehydrogenase from Bovine Milk with Inhibitor TEI-6720 Bound
PDB Compounds: (A:)

SCOP Domain Sequences for d1n5xa6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5xa6 d.145.1.3 (A:192-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus)}
spslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaq
hpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvekt
lleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtk
ltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysre

SCOP Domain Coordinates for d1n5xa6:

Click to download the PDB-style file with coordinates for d1n5xa6.
(The format of our PDB-style files is described here.)

Timeline for d1n5xa6: