Lineage for d1n5xa5 (1n5x A:695-1332)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540508Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 2540509Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 2540510Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. 2540572Protein Xanthine oxidase, C-terminal domain [56008] (1 species)
  7. 2540573Species Cow (Bos taurus) [TaxId:9913] [56009] (11 PDB entries)
    Uniprot P80457
  8. 2540592Domain d1n5xa5: 1n5x A:695-1332 [85346]
    Other proteins in same PDB: d1n5xa1, d1n5xa2, d1n5xa3, d1n5xa4, d1n5xa6, d1n5xb1, d1n5xb2, d1n5xb3, d1n5xb4, d1n5xb6
    complexed with fad, fes, mos, mte, tei

Details for d1n5xa5

PDB Entry: 1n5x (more details), 2.8 Å

PDB Description: Xanthine Dehydrogenase from Bovine Milk with Inhibitor TEI-6720 Bound
PDB Compounds: (A:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d1n5xa5:

Sequence, based on SEQRES records: (download)

>d1n5xa5 d.133.1.1 (A:695-1332) Xanthine oxidase, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk
geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval
aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls
hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc
glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk
krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal
kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe
dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl
rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs
iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf
rldspatpekirnacvdkfttlcvtgapgnckpwslrv

Sequence, based on observed residues (ATOM records): (download)

>d1n5xa5 d.133.1.1 (A:695-1332) Xanthine oxidase, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk
geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval
aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls
hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc
glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk
krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal
kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe
dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl
rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs
iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf
rldspatpekirnacvdkfttlkpwslrv

SCOPe Domain Coordinates for d1n5xa5:

Click to download the PDB-style file with coordinates for d1n5xa5.
(The format of our PDB-style files is described here.)

Timeline for d1n5xa5: