Lineage for d1n5xa3 (1n5x A:537-694)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 410851Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 410852Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (4 proteins)
  6. 410885Protein Xanthine oxidase, domain 5 (?) [54670] (1 species)
  7. 410886Species Cow (Bos taurus) [TaxId:9913] [54671] (3 PDB entries)
  8. 410890Domain d1n5xa3: 1n5x A:537-694 [85344]
    Other proteins in same PDB: d1n5xa1, d1n5xa2, d1n5xa4, d1n5xa5, d1n5xa6, d1n5xb1, d1n5xb2, d1n5xb4, d1n5xb5, d1n5xb6

Details for d1n5xa3

PDB Entry: 1n5x (more details), 2.8 Å

PDB Description: Xanthine Dehydrogenase from Bovine Milk with Inhibitor TEI-6720 Bound
PDB Compounds: (A:)

SCOP Domain Sequences for d1n5xa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5xa3 d.41.1.1 (A:537-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus)}
kldptytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddi
pryenelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfa
kdtvtcvghiigavvadtpehaeraahvvkvtyedlpa

SCOP Domain Coordinates for d1n5xa3:

Click to download the PDB-style file with coordinates for d1n5xa3.
(The format of our PDB-style files is described here.)

Timeline for d1n5xa3: