SCOP 1.73: Domain d1n5xa1: 1n5x A:93-165

Lineage for d1n5xa1 (1n5x A:93-165)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family)
   contains 2Fe-2S cluster

5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins)

6. Protein Xanthine oxidase, domain 2 [47746] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47747] (5 PDB entries)

8. Domain d1n5xa1: 1n5x A:93-165 [85342]
   Other proteins in same PDB: d1n5xa2, d1n5xa3, d1n5xa4, d1n5xa5, d1n5xa6, d1n5xb2, d1n5xb3, d1n5xb4, d1n5xb5, d1n5xb6

Details for d1n5xa1

PDB Entry: 1n5x, 2.8 Å

PDB Description: Xanthine Dehydrogenase from Bovine Milk with Inhibitor TEI-6720 Bound

PDB Compounds: (A:) Xanthine Dehydrogenase

SCOP Domain Sequences for d1n5xa1:

Sequence; same for both SEQRES and ATOM records:

>d1n5xa1 a.56.1.1 (A:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

Timeline for d1n5xa1:

• d1n5xa1 first appeared in SCOP 1.65
  
• d1n5xa1 appears in SCOP 1.71
  
• d1n5xa1 appears in SCOP 1.75
  
• d1n5xa1 appears in the current release, SCOPe 2.08