Lineage for d1n5xa1 (1n5x A:93-165)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356706Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 356707Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
    contains 2Fe-2S cluster
  5. 356708Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (4 proteins)
  6. 356741Protein Xanthine oxidase, domain 2 [47746] (1 species)
  7. 356742Species Cow (Bos taurus) [TaxId:9913] [47747] (3 PDB entries)
  8. 356746Domain d1n5xa1: 1n5x A:93-165 [85342]
    Other proteins in same PDB: d1n5xa2, d1n5xa3, d1n5xa4, d1n5xa5, d1n5xa6, d1n5xb2, d1n5xb3, d1n5xb4, d1n5xb5, d1n5xb6

Details for d1n5xa1

PDB Entry: 1n5x (more details), 2.8 Å

PDB Description: Xanthine Dehydrogenase from Bovine Milk with Inhibitor TEI-6720 Bound
PDB Compounds: (A:)

SCOP Domain Sequences for d1n5xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5xa1 a.56.1.1 (A:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus)}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOP Domain Coordinates for d1n5xa1:

Click to download the PDB-style file with coordinates for d1n5xa1.
(The format of our PDB-style files is described here.)

Timeline for d1n5xa1: