SCOPe 2.08: Domain d1n5xa1: 1n5x A:93-165

Lineage for d1n5xa1 (1n5x A:93-165)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families)
   contains 2Fe-2S cluster

5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)

6. Protein Xanthine oxidase, domain 2 [47746] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47747] (11 PDB entries)
   Uniprot P80457

8. Domain d1n5xa1: 1n5x A:93-165 [85342]
   Other proteins in same PDB: d1n5xa2, d1n5xa3, d1n5xa4, d1n5xa5, d1n5xa6, d1n5xb2, d1n5xb3, d1n5xb4, d1n5xb5, d1n5xb6
   complexed with fad, fes, mos, mte, tei

Details for d1n5xa1

PDB Entry: 1n5x, 2.8 Å

PDB Description: Xanthine Dehydrogenase from Bovine Milk with Inhibitor TEI-6720 Bound

PDB Compounds: (A:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d1n5xa1:

Sequence; same for both SEQRES and ATOM records:

>d1n5xa1 a.56.1.1 (A:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

Timeline for d1n5xa1:

• d1n5xa1 first appeared in SCOP 1.65
  
• d1n5xa1 appears in SCOPe 2.07