Lineage for d1n5ua3 (1n5u A:389-584)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 285651Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulphide-linked subdomains
  4. 285652Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 285653Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 285654Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 285655Species Human (Homo sapiens) [TaxId:9606] [48555] (25 PDB entries)
  8. 285658Domain d1n5ua3: 1n5u A:389-584 [85341]
    complexed with hem, myr

Details for d1n5ua3

PDB Entry: 1n5u (more details), 1.9 Å

PDB Description: x-ray study of human serum albumin complexed with heme

SCOP Domain Sequences for d1n5ua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5ua3 a.126.1.1 (A:389-584) Serum albumin {Human (Homo sapiens)}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaalg

SCOP Domain Coordinates for d1n5ua3:

Click to download the PDB-style file with coordinates for d1n5ua3.
(The format of our PDB-style files is described here.)

Timeline for d1n5ua3: