Lineage for d1n5ua1 (1n5u A:2-196)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1503613Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1503614Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 1503615Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1503616Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 1503617Species Human (Homo sapiens) [TaxId:9606] [48555] (69 PDB entries)
    Uniprot P02768 29-596
  8. 1503618Domain d1n5ua1: 1n5u A:2-196 [85339]
    complexed with hem, myr

Details for d1n5ua1

PDB Entry: 1n5u (more details), 1.9 Å

PDB Description: x-ray study of human serum albumin complexed with heme
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d1n5ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5ua1 a.126.1.1 (A:2-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
ahksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaen
cdkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevd
vmctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpk
ldelrdegkassakq

SCOPe Domain Coordinates for d1n5ua1:

Click to download the PDB-style file with coordinates for d1n5ua1.
(The format of our PDB-style files is described here.)

Timeline for d1n5ua1: