Lineage for d1n5ua1 (1n5u A:2-196)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448398Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 448399Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 448400Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 448401Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 448402Species Human (Homo sapiens) [TaxId:9606] [48555] (26 PDB entries)
  8. 448403Domain d1n5ua1: 1n5u A:2-196 [85339]

Details for d1n5ua1

PDB Entry: 1n5u (more details), 1.9 Å

PDB Description: x-ray study of human serum albumin complexed with heme

SCOP Domain Sequences for d1n5ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5ua1 a.126.1.1 (A:2-196) Serum albumin {Human (Homo sapiens)}
ahksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaen
cdkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevd
vmctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpk
ldelrdegkassakq

SCOP Domain Coordinates for d1n5ua1:

Click to download the PDB-style file with coordinates for d1n5ua1.
(The format of our PDB-style files is described here.)

Timeline for d1n5ua1: