Lineage for d1n5na_ (1n5n A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2606868Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 2606869Protein Peptide deformylase [56422] (11 species)
  7. 2606967Species Pseudomonas aeruginosa [TaxId:287] [75578] (4 PDB entries)
  8. 2606970Domain d1n5na_: 1n5n A: [85336]
    complexed with gol, zn

Details for d1n5na_

PDB Entry: 1n5n (more details), 1.8 Å

PDB Description: crystal structure of peptide deformylase from pseudomonas aeruginosa
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d1n5na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5na_ d.167.1.1 (A:) Peptide deformylase {Pseudomonas aeruginosa [TaxId: 287]}
mailnilefpdprlrtiakpvevvddavrqliddmfetmyeapgiglaatqvnvhkrivv
mdlsedkseprvfinpefeplteemdqyqegclsvpgfyenvdrpqkvrikaldrdgnpf
eevaegllavciqhecdhlngklfvdylstlkrdrirkklekqhrqq

SCOPe Domain Coordinates for d1n5na_:

Click to download the PDB-style file with coordinates for d1n5na_.
(The format of our PDB-style files is described here.)

Timeline for d1n5na_: