Lineage for d1n5la_ (1n5l A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109670Protein Thymidylate kinase [52563] (4 species)
  7. 2109708Species Mycobacterium tuberculosis [TaxId:1773] [69482] (9 PDB entries)
  8. 2109718Domain d1n5la_: 1n5l A: [85334]
    complexed with act, dpo, mg, tmp, tyd

Details for d1n5la_

PDB Entry: 1n5l (more details), 2.3 Å

PDB Description: crystal structure of mycobacterium tuberculosis thymidylate kinase crystallized in sodium malonate, after catalysis in the crystal (2.3 a resolution)
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d1n5la_:

Sequence, based on SEQRES records: (download)

>d1n5la_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
elaaqgwggrwlvvgadvdpgrlaatla

Sequence, based on observed residues (ATOM records): (download)

>d1n5la_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagerdnyerdaelqqrtgavyaelaaqgwggrwlv
vgadvdpgrlaatla

SCOPe Domain Coordinates for d1n5la_:

Click to download the PDB-style file with coordinates for d1n5la_.
(The format of our PDB-style files is described here.)

Timeline for d1n5la_: